PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00287.1.g00080.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family M-type_MADS
Protein Properties Length: 248aa    MW: 27504.5 Da    PI: 9.5985
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00287.1.g00080.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF96.41.2e-30192242151
                                   S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                        SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 
                                   krien++ rqvtf+kRrng+lKKA+ELSvLCd+eva+i+fss+g+lyeys+
  Zpz_sc00287.1.g00080.1.am.mk 192 KRIENTTSRQVTFCKRRNGLLKKAYELSVLCDVEVALIVFSSRGRLYEYSN 242
                                   79***********************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.6E-40184243IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.83E-28184244IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.927184244IPR002100Transcription factor, MADS-box
CDDcd002652.24E-39185248No hitNo description
PROSITE patternPS003500186240IPR002100Transcription factor, MADS-box
PRINTSPR004042.2E-31186206IPR002100Transcription factor, MADS-box
PfamPF003191.5E-26193240IPR002100Transcription factor, MADS-box
PRINTSPR004042.2E-31206221IPR002100Transcription factor, MADS-box
PRINTSPR004042.2E-31221242IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MHGDQAVRKS GHACIWERTA APCLHSCTVS ISFTFNTHRS VCLYGACLVD RGSALGIRAS  60
AVVGDDDGFP FPGGFLGADR SIAAVRFDRE EHLVAGVQGR GGSSTETGRW SWGGVWGRIR  120
CCSPELGNST LTDRHTALIA FCRWWCRGGG IGFYYCKAYV RGAAKLAREL RCVRSQLFRV  180
SCRMGRGRIE IKRIENTTSR QVTFCKRRNG LLKKAYELSV LCDVEVALIV FSSRGRLYEY  240
SNNRSVDI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P3e-18184242159Myocyte-specific enhancer factor 2B
1tqe_Q3e-18184242159Myocyte-specific enhancer factor 2B
1tqe_R3e-18184242159Myocyte-specific enhancer factor 2B
1tqe_S3e-18184242159Myocyte-specific enhancer factor 2B
3mu6_A2e-18185242158Myocyte-specific enhancer factor 2A
3mu6_B2e-18185242158Myocyte-specific enhancer factor 2A
3mu6_C2e-18185242158Myocyte-specific enhancer factor 2A
3mu6_D2e-18185242158Myocyte-specific enhancer factor 2A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ0027189e-75KJ002718.1 Phyllostachys edulis MADS-box protein 13 mRNA, complete cds.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12938398
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09960.33e-35MIKC_MADS family protein